PDB entry 2hvk

View 2hvk on RCSB PDB site
Description: crystal structure of the KcsA-Fab-TBA complex in high K+
Class: Membrane Protein
Keywords: potassium channel, membrane protein, tetrabutylammonium, K+, KcsA
Deposited on 2006-07-28, released 2007-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HVK (0-218)
    Domains in SCOPe 2.06: d2hvka1, d2hvka2
  • Chain 'B':
    Compound: antibody fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HVK (0-211)
    Domains in SCOPe 2.06: d2hvkb1, d2hvkb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOPe 2.06: d2hvkc_
  • Heterogens: K, L2C, F09, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvkA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvkB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hvkC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvkC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh