PDB entry 2hvk

View 2hvk on RCSB PDB site
Description: crystal structure of the KcsA-Fab-TBA complex in high K+
Class: Membrane Protein
Keywords: potassium channel, membrane protein, tetrabutylammonium, K+, KcsA
Deposited on 2006-07-28, released 2007-02-20
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: MUS MUSCULUS
  • Chain 'B':
    Compound: antibody fab light chain
    Species: MUS MUSCULUS
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOP 1.75: d2hvkc1
  • Heterogens: K, L2C, F09, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2hvkC (C:)
mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrgh

    Sequence, based on observed residues (ATOM records): (download) 
    >2hvkC (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh