PDB entry 2hvj

View 2hvj on RCSB PDB site
Description: Crystal structure of KcsA-Fab-TBA complex in low K+
Class: membrane protein
Keywords: potassium channel, membrane protein, tetrabutylammonium, K+, KcsA
Deposited on 2006-07-28, released 2007-02-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HVJ (Start-218)
  • Chain 'B':
    Compound: antibody fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HVJ (0-211)
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOPe 2.02: d2hvjc1
  • Heterogens: K, L2C, F09, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hvjC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvjC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh