PDB entry 2hvj
View 2hvj on RCSB PDB site
Description: Crystal structure of KcsA-Fab-TBA complex in low K+
Class: membrane protein
Keywords: potassium channel, membrane protein, tetrabutylammonium, K+, KcsA
Deposited on
2006-07-28, released
2007-02-20
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.222
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: antibody fab heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: antibody fab light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Gene: kcsA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2hvjc1 - Heterogens: K, L2C, F09, TBA, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2hvjC (C:)
mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrgh
Sequence, based on observed residues (ATOM records): (download)
>2hvjC (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh