PDB entry 2hvi

View 2hvi on RCSB PDB site
Description: ddCTP:G pair in the polymerase active site (0 position)
Class: Transferase/DNA
Keywords: DNA Polymerase I, DNA replication, Klenow Fragment, Protein-DNA complex, closed conformation
Deposited on 2006-07-28, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Bacillus stearothermophilus
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hvia1, d2hvia2
  • Chain 'B':
    Compound: 5'-d(*cp*cp*tp*gp*ap*cp*tp*cp*(ddg))-3'
  • Chain 'C':
    Compound: 5'-d(*c*ap*tp*gp*cp*gp*ap*gp*tp*cp*ap*gp*g)-3'
  • Chain 'D':
    Compound: DNA polymerase I
    Species: Bacillus stearothermophilus
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hvid1, d2hvid2
  • Chain 'E':
    Compound: 5'-d(*cp*cp*tp*gp*ap*cp*tp*cp*(ddg))-3'
  • Chain 'F':
    Compound: 5'-d(*c*ap*tp*gp*cp*gp*ap*gp*tp*cp*ap*gp*g)-3'
  • Heterogens: SUC, MG, SO4, DCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hviA (A:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    patkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnygivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hviD (D:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    patkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnygivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.