PDB entry 2hve

View 2hve on RCSB PDB site
Description: S120G mutant of human nucleoside diphosphate kinase A complexed with ADP
Class: signaling protein,transferase
Keywords: s120g mutant; complex ADP, signaling protein, transferase
Deposited on 2006-07-28, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (Start-151)
      • engineered (119)
    Domains in SCOPe 2.07: d2hvea_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (Start-151)
      • engineered (119)
    Domains in SCOPe 2.07: d2hveb_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (Start-151)
      • engineered (119)
    Domains in SCOPe 2.07: d2hvec_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hveA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgg
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hveA (A:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihggd
    svesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hveB (B:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgg
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hveB (B:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihggd
    svesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hveC (C:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgg
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hveC (C:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihggd
    svesaekeiglwfhpeelvdytscaqnwiye