PDB entry 2hv6

View 2hv6 on RCSB PDB site
Description: Crystal structure of the phosphotyrosyl phosphatase activator
Class: Unknown Function
Keywords: phosphotyrosyl phosphatase activator, phosphatase, PP2A, phosphatase specificity, Unknown Function
Deposited on 2006-07-27, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hv6a1
  • Chain 'B':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hv6b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hv6A (A:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv6A (A:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hv6B (B:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv6B (B:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epaglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfitemktgp
    faehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvts