PDB entry 2hv4

View 2hv4 on RCSB PDB site
Description: NMR solution structure refinement of yeast iso-1-ferrocytochrome c
Class: electron transport
Keywords: Heme protein
Deposited on 2006-07-27, released 2006-09-26
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-26, with a file datestamp of 2007-06-04.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae
  Gene: CYC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered (106)
  Domains in SCOP 1.73: d2hv4a1
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hv4A (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate