PDB entry 2huy
View 2huy on RCSB PDB site
Description: X-ray crystal structure of the complex between the Grb2-SH2 domain and a flexible ligand, fpYVN.
Class: hormone/growth factor
Keywords: Flexible, constrained, entropy, Grb2-SH2, ligand preorganization, HORMONE/GROWTH FACTOR COMPLEX
Deposited on
2006-07-27, released
2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated
2008-08-12, with a file datestamp of
2008-08-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Growth factor receptor-bound protein 2
Species: Homo sapiens [TaxId:9606]
Gene: GRB2, ASH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2huya_ - Heterogens: YVN, FMT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2huyA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2huyA (A:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp