PDB entry 2hup

View 2hup on RCSB PDB site
Description: Crystal structure of human RAB43 in complex with GDP
Class: signaling protein
Keywords: g-protein, rab, GDP, structural genomics, structural genomics consortium, sgc, signaling protein
Deposited on 2006-07-27, released 2006-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.233
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAS-related protein RAB-43
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hupa_
  • Chain 'B':
    Compound: RAS-related protein RAB-43
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hupb_
  • Heterogens: MG, GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hupA (A:)
    mgsshhhhhhssglvprgsgdpdeqydflfklvlvgdasvgktcvvqrfktgafserqgs
    tigvdftmktleiqgkrvklqiwdtagqerfrtitqsyyrsangailayditkrssflsv
    phwiedvrkyagsnivqllignksdlselrevslaeaqslaehydilcaietsakdssnv
    eeaflrvatelimrhggplfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hupA (A:)
    ydflfklvlvgdasvgktcvvqrfktgafdftmktleiqgkrvklqiwdtagqerfrtit
    qsyyrsangailayditkrssflsvphwiedvrkyagsnivqllignksdlselrevsla
    eaqslaehydilcaietsakdssnveeaflrvatelimrhgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hupB (B:)
    mgsshhhhhhssglvprgsgdpdeqydflfklvlvgdasvgktcvvqrfktgafserqgs
    tigvdftmktleiqgkrvklqiwdtagqerfrtitqsyyrsangailayditkrssflsv
    phwiedvrkyagsnivqllignksdlselrevslaeaqslaehydilcaietsakdssnv
    eeaflrvatelimrhggplfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hupB (B:)
    ydflfklvlvgdasvgktcvvqrfktgafdftmktleirvklqiwdtagqerfrtitqsy
    yrsangailayditkrssflsvphwiedvrkyagsnivqllignksdlselrevslaeaq
    slaehydilcaietsakdssnveeaflrvatelimrh