PDB entry 2huo

View 2huo on RCSB PDB site
Description: Crystal structure of mouse myo-inositol oxygenase in complex with substrate
Class: oxidoreductase
Keywords: Protein-substrate complex, HD domain fold, oxidoreductase
Deposited on 2006-07-27, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol oxygenase
    Species: Mus musculus [TaxId:10090]
    Gene: Miox, Aldrl6, Rsor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2huoa1
  • Heterogens: FE, OH, INS, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2huoA (A:)
    gamgmkvdvgpdpslvyrpdvdpemakskdsfrnytsgplldrvfttyklmhthqtvdfv
    srkriqygsfsykkmtimeavgmlddlvdesdpdvdfpnsfhafqtaegirkahpdkdwf
    hlvgllhdlgkimalwgepqwavvgdtfpvgcrpqasvvfcdstfqdnpdlqdprystel
    gmyqphcglenvlmswghdeylyqmmkfnkfslpseafymirfhsfypwhtggdyrqlcs
    qqdldmlpwvqefnkfdlytkcpdlpdveslrpyyqglidkycpgtlsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2huoA (A:)
    frnytsgplldrvfttyklmhthqtvdfvsrkriqygsfsykkmtimeavgmlddlvdes
    dpdvdfpnsfhafqtaegirkahpdkdwfhlvgllhdlgkimalwgepqwavvgdtfpvg
    crpqasvvfcdstfqdnpdlqdprystelgmyqphcglenvlmswghdeylyqmmkfnkf
    slpseafymirfhsfypwhtggdyrqlcsqqdldmlpwvqefnkfdlytkcpdlpdvesl
    rpyyqglidkycpgtlsw