PDB entry 2huj

View 2huj on RCSB PDB site
Description: Crystal structure of a protein of uknown function (NP_471338.1) from Listeria innocua at 1.74 A resolution
Class: structural genomics, unknown function
Keywords: NP_471338.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, UNKNOWN FUNCTION
Deposited on 2006-07-26, released 2006-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.175
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin2004 protein
    Species: Listeria innocua [TaxId:1642]
    Gene: NP_471338.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92AB8 (19-End)
      • leader sequence (14-18)
      • modified residue (19)
      • modified residue (55)
      • modified residue (99)
    Domains in SCOPe 2.06: d2huja1, d2huja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hujA (A:)
mgsdkihhhhhhenlyfqgmellirteqlllqneknwelylsnreeekpfdfykdmkpfv
deakrcaddflelaipwvnterppylgelqlrqacdnvqmtavsafngrsfykhfldhyq
stkytltrvrdflkrkeesm

    Sequence, based on observed residues (ATOM records): (download) 
    >2hujA (A:)
lyfqgmellirteqlllqneknwelylsnreeekpfdfykdmkpfvdeakrcaddflela
ipwvnterppylgelqlrqacdnvqmtavsafngrsfykhfldhyqstkytltrvrdflk
rkees