PDB entry 2huj

View 2huj on RCSB PDB site
Description: Crystal structure of a protein of uknown function (NP_471338.1) from Listeria innocua at 1.74 A resolution
Class: structural genomics, unknown function
Keywords: NP_471338.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-07-26, released 2006-08-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.175
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin2004 protein
    Species: Listeria innocua
    Gene: NP_471338.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92AB8 (19-End)
      • leader sequence (14-18)
      • modified residue (19)
      • modified residue (55)
      • modified residue (99)
    Domains in SCOP 1.73: d2huja1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hujA (A:)
    mgsdkihhhhhhenlyfqgmellirteqlllqneknwelylsnreeekpfdfykdmkpfv
    deakrcaddflelaipwvnterppylgelqlrqacdnvqmtavsafngrsfykhfldhyq
    stkytltrvrdflkrkeesm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hujA (A:)
    lyfqgmellirteqlllqneknwelylsnreeekpfdfykdmkpfvdeakrcaddflela
    ipwvnterppylgelqlrqacdnvqmtavsafngrsfykhfldhyqstkytltrvrdflk
    rkees