PDB entry 2huh

View 2huh on RCSB PDB site
Description: Crystal structure of a duf2027 family protein (bt_2179) from bacteroides thetaiotaomicron at 1.54 A resolution
Class: unknown function
Keywords: Putative dna mismatch repair protein, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2006-07-26, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative DNA mismatch repair protein
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: NP_811092.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A5Q9 (0-146)
      • modified residue (24-25)
      • modified residue (80)
    Domains in SCOPe 2.08: d2huha1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2huhA (A:)
rqpevrggdtlnvflayvpedakammttpfeaylvndsnyylyytylsaegkawnnrshg
lvepntkllleeftkdvlnemervavqliafkdgkpaaikpavsvelridtvkfyklhtf
sasdffeepaliydivkddvpakqvyv