PDB entry 2hug

View 2hug on RCSB PDB site
Description: 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide
Class: plant protein
Keywords: Chromo-2 domain, cpSRP43, LHCP, thylakoid, protein translocation, cpSRP54, PLANT PROTEIN
Deposited on 2006-07-26, released 2007-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle 43 kDa protein, chloroplast
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CAO
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22265 (2-56)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2huga2, d2huga3
  • Chain 'B':
    Compound: Signal recognition particle 54 kDa protein, chloroplast
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hugA (A:)
gsqvfeyaevdeivekrgkgkdveylvrwkdggdcewvkgvhvaedvakdyedgley

  • Chain 'B':
    No sequence available.