PDB entry 2huf

View 2huf on RCSB PDB site
Description: Crystal structure of Aedes aegypti alanine glyoxylate aminotransferase
Class: transferase
Keywords: Alpha and beta protein, PLP-dependent transferase
Deposited on 2006-07-26, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanine glyoxylate aminotransferase
    Species: Aedes aegypti [TaxId:7159]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM4 (0-End)
      • modified residue (205)
    Domains in SCOPe 2.07: d2hufa_
  • Chain 'B':
    Compound: Alanine glyoxylate aminotransferase
    Species: Aedes aegypti [TaxId:7159]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM4 (0-End)
      • modified residue (205)
    Domains in SCOPe 2.07: d2hufb_
  • Heterogens: 1BO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hufA (A:)
    meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg
    vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv
    rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd
    tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd
    mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq
    dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm
    gqnattervdrvlqvfqeavaavkpdvqvkgkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hufA (A:)
    meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg
    vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv
    rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd
    tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd
    mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq
    dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm
    gqnattervdrvlqvfqeavaavkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hufB (B:)
    meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg
    vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv
    rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd
    tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd
    mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq
    dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm
    gqnattervdrvlqvfqeavaavkpdvqvkgkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hufB (B:)
    meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg
    vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv
    rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd
    tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd
    mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq
    dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm
    gqnattervdrvlqvfqeavaavkp