PDB entry 2hu8

View 2hu8 on RCSB PDB site
Description: Binding of inhibitors by Acylaminoacyl peptidase
Class: hydrolase
Keywords: alpha/beta hydrolase, beta-propeller, enzyme-inhibitor complex, HYDROLASE
Deposited on 2006-07-26, released 2007-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YBQ2 (Start-581)
      • engineered (444)
    Domains in SCOPe 2.08: d2hu8a1, d2hu8a2
  • Chain 'B':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YBQ2
      • engineered (444)
    Domains in SCOPe 2.08: d2hu8b1, d2hu8b2
  • Heterogens: BE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hu8A (A:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgyayggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu8A (A:)
    efsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsv
    ldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvft
    gatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssggl
    rvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrpta
    itwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppr
    ivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvh
    ggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaa
    rwaresglaselyimgyayggymtlcaltmkpglfkagvagasvvdweemyelsdaafrn
    fieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfe
    ahiipdaghaintmedavkillpavfflatqrerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hu8B (B:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgyayggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu8B (B:)
    fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
    dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
    atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
    vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
    twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
    vslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhg
    gpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaar
    waresglaselyimgyayggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnf
    ieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfea
    hiipdaghaintmedavkillpavfflatqrer