PDB entry 2hu7

View 2hu7 on RCSB PDB site
Description: Binding of inhibitors by Acylaminoacyl peptidase
Class: hydrolase
Keywords: alpha/beta hydrolase, beta-propeller, enzyme-inhibitor complex
Deposited on 2006-07-26, released 2007-05-15
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hu7a1, d2hu7a2
  • Chain 'B':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hu7b1, d2hu7b2
  • Heterogens: ACE, PHE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hu7A (A:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu7A (A:)
    fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
    dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
    atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
    vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
    twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
    vslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhg
    gpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaar
    waresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnf
    ieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfea
    hiipdaghaintmedavkillpavfflatqrer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hu7B (B:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu7B (B:)
    fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
    dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
    atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
    vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
    twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
    vslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhg
    gpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaar
    waresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnf
    ieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfea
    hiipdaghaintmedavkillpavfflatqrer