PDB entry 2hu6

View 2hu6 on RCSB PDB site
Description: Crystal structure of human MMP-12 in complex with acetohydroxamic acid and a bicyclic inhibitor
Class: hydrolase
Keywords: MMP-12, matrix metalloproteinase, macrophage metalloelastase, inhibitor, hydroxamic acid, drug design
Deposited on 2006-07-26, released 2006-12-19
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.163
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered (66)
    Domains in SCOP 1.75: d2hu6a1
  • Heterogens: ZN, CA, 37A, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hu6A (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu6A (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg