PDB entry 2hu6

View 2hu6 on RCSB PDB site
Description: Crystal structure of human MMP-12 in complex with acetohydroxamic acid and a bicyclic inhibitor
Class: hydrolase
Keywords: MMP-12, matrix metalloproteinase, macrophage metalloelastase, inhibitor, hydroxamic acid, drug design, HYDROLASE
Deposited on 2006-07-26, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered (66)
    Domains in SCOPe 2.08: d2hu6a_
  • Heterogens: ZN, CA, 37A, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hu6A (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

    Sequence, based on observed residues (ATOM records): (download) 
    >2hu6A (A:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg