PDB entry 2hu5

View 2hu5 on RCSB PDB site
Description: Binding of inhibitors by Acylaminoacyl-peptidase
Class: hydrolase
Keywords: alpha/beta hydrolase, beta-propeller, enzyme-inhibitor complex, HYDROLASE
Deposited on 2006-07-26, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hu5a1, d2hu5a2
  • Chain 'B':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hu5b1, d2hu5b2
  • Heterogens: GLY, PHE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hu5A (A:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu5A (A:)
    fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
    dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
    atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
    vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
    twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
    vslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhg
    gpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaar
    waresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnf
    ieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfea
    hiipdaghaintmedavkillpavfflatqrer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hu5B (B:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu5B (B:)
    efsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsv
    ldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvft
    gatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssggl
    rvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrpta
    itwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppr
    ivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvh
    ggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaa
    rwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrn
    fieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfe
    ahiipdaghaintmedavkillpavfflatqrerr