PDB entry 2hu4

View 2hu4 on RCSB PDB site
Description: N1 neuraminidase in complex with oseltamivir 2
Class: hydrolase
Keywords: N1, neuraminidase, oseltamivir, hydrolase
Deposited on 2006-07-26, released 2006-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4b_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4c_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4d_
  • Chain 'E':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4e_
  • Chain 'F':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4f_
  • Chain 'G':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4g_
  • Chain 'H':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered mutation (170)
    Domains in SCOPe 2.05: d2hu4h_
  • Heterogens: G39

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hu4A (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4A (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hu4B (B:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4B (B:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hu4C (C:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4C (C:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hu4D (D:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4D (D:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hu4E (E:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4E (E:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hu4F (F:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4F (F:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hu4G (G:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4G (G:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hu4H (H:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hu4H (H:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti