PDB entry 2hty

View 2hty on RCSB PDB site
Description: N1 neuraminidase
Class: hydrolase
Keywords: N1, neuraminidase, hydrolase
Deposited on 2006-07-26, released 2006-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htya_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htyb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htyc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htyd_
  • Chain 'E':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htye_
  • Chain 'F':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htyf_
  • Chain 'G':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htyg_
  • Chain 'H':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-End)
      • engineered (86)
    Domains in SCOPe 2.05: d2htyh_
  • Heterogens: NDG, NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2htyA (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyA (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2htyB (B:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyB (B:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2htyC (C:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyC (C:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2htyD (D:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyD (D:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2htyE (E:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyE (E:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2htyF (F:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyF (F:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2htyG (G:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyG (G:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2htyH (H:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htyH (H:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti