PDB entry 2hti

View 2hti on RCSB PDB site
Description: crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution
Class: fmn-binding protein
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, fmn-binding protein
Deposited on 2006-07-25, released 2006-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH0577 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: 10173191
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFA8
      • modified residue (64)
      • modified residue (95)
      • modified residue (116)
      • modified residue (119)
    Domains in SCOPe 2.08: d2htia1
  • Heterogens: NA, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2htiA (A:)
    gmnairytkreckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgaseg
    rkikmieanpevcfticedlgtivspvpahtdtaymsviifgtiepvsaieegteamqqm
    ldkyvpgyyhsplaashvekyrsslgsrtaiykiscrertakvnepieslkfypgrnvsv
    dkdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2htiA (A:)
    eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp
    evcfticedlaymsviifgtiepvsaieegteamqqmldkyvpslgsrtaiykiscrert
    akvnep