PDB entry 2ht7

View 2ht7 on RCSB PDB site
Description: N8 neuraminidase in open complex with oseltamivir
Class: hydrolase
Keywords: N8, neuraminidase, oseltamivir, HYDROLASE
Deposited on 2006-07-25, released 2006-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ht7a_
  • Heterogens: G39

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ht7A (A:)
    tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyevadwswhdgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ht7A (A:)
    tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyevadwswhdgailpfdi