PDB entry 2hsz

View 2hsz on RCSB PDB site
Description: Crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 A resolution
Class: hydrolase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase
Deposited on 2006-07-24, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novel predicted phosphatase
    Species: Histophilus somni [TaxId:205914]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hsza1, d2hsza2
  • Chain 'B':
    Compound: novel predicted phosphatase
    Species: Histophilus somni [TaxId:205914]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hszb2, d2hszb3
  • Heterogens: ACT, CL, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hszA (A:)
    mgsdkihhhhhhenlyfqgmtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasen
    lvmtwigngadvlsqravdwackqaekeltedefkyfkrqfgfyygenlcnisrlypnvk
    etlealkaqgyilavvtnkptkhvqpiltafgidhlfsemlggqslpeikphpapfyylc
    gkfglypkqilfvgdsqndifaahsagcavvgltygynynipiaqskpdwifddfadilk
    itq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hszA (A:)
    gmtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqrav
    dwackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtn
    kptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqn
    difaahsagcavvgltygynynipiaqskpdwifddfadilkitq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hszB (B:)
    mgsdkihhhhhhenlyfqgmtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasen
    lvmtwigngadvlsqravdwackqaekeltedefkyfkrqfgfyygenlcnisrlypnvk
    etlealkaqgyilavvtnkptkhvqpiltafgidhlfsemlggqslpeikphpapfyylc
    gkfglypkqilfvgdsqndifaahsagcavvgltygynynipiaqskpdwifddfadilk
    itq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hszB (B:)
    gmtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqrav
    dwackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtn
    kptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqn
    difaahsagcavvgltygynynipiaqskpdwifddfadilkitq