PDB entry 2hsp

View 2hsp on RCSB PDB site
Description: solution structure of the sh3 domain of phospholipase cgamma
Class: phosphoric diester hydrolase
Keywords: phosphoric diester hydrolase
Deposited on 1994-06-13, released 1994-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c-gamma (sh3 domain)
    Species: HOMO SAPIENS
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hspa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hspA (A:)
gsptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyve
emvnpegihrd