PDB entry 2hsp

View 2hsp on RCSB PDB site
Description: solution structure of the sh3 domain of phospholipase cgamma
Deposited on 1994-06-13, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2hsp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hsp_ (-)
    gsptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyve
    emvnpegihrd