PDB entry 2hsn

View 2hsn on RCSB PDB site
Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes
Class: Ligase/RNA Binding Protein
Keywords: protein complex protein interaction GST-fold, Ligase/RNA Binding Protein COMPLEX
Deposited on 2006-07-22, released 2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase, cytoplasmic
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MES1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00958 (1-159)
      • cloning artifact (0)
  • Chain 'B':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hsnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2hsnB (B:)
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
hd

    Sequence, based on observed residues (ATOM records): (download) 
    >2hsnB (B:)
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein