PDB entry 2hsj

View 2hsj on RCSB PDB site
Description: The structure of a putative platelet activating factor from Streptococcus pneumonia.
Class: structural genomics, unknown function
Keywords: platelet activating factor, Streptococcus pneumonia, structral genomics, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-07-21, released 2006-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative platelet activating factor
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP1450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97PY9 (3-213)
      • modified residue (3)
      • modified residue (167)
    Domains in SCOPe 2.06: d2hsja1
  • Chain 'B':
    Compound: Putative platelet activating factor
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP1450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97PY9 (3-213)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (167)
    Domains in SCOPe 2.06: d2hsjb2, d2hsjb3
  • Chain 'C':
    Compound: Putative platelet activating factor
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP1450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97PY9 (3-213)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (167)
    Domains in SCOPe 2.06: d2hsjc2, d2hsjc3
  • Chain 'D':
    Compound: Putative platelet activating factor
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP1450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97PY9 (3-213)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (167)
    Domains in SCOPe 2.06: d2hsjd2, d2hsjd3
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hsjA (A:)
    snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
    vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
    dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
    dqagqlkkeyttdglhlsiagyqalskslkdyly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hsjA (A:)
    mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnr
    girgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyp
    lteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqa
    gqlkkeyttdglhlsiagyqalskslkdyly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hsjB (B:)
    snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
    vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
    dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
    dqagqlkkeyttdglhlsiagyqalskslkdyly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hsjB (B:)
    amavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivn
    rgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardy
    plteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdq
    agqlkkeyttdglhlsiagyqalskslkdyly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hsjC (C:)
    snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
    vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
    dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
    dqagqlkkeyttdglhlsiagyqalskslkdyly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hsjC (C:)
    amavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivn
    rgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardy
    plteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdq
    agqlkkeyttdglhlsiagyqalskslkdyly
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hsjD (D:)
    snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
    vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
    dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
    dqagqlkkeyttdglhlsiagyqalskslkdyly