PDB entry 2hsg

View 2hsg on RCSB PDB site
Description: Structure of transcription regulator CcpA in its DNA-free state
Class: transcription regulator
Keywords: ccpa, transcriptional regulator, transcription regulator
Deposited on 2006-07-21, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.281
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hsga1, d2hsga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hsgA (A:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hsgA (A:)
    nvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskttt
    vgviipsnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgiifms
    gnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkniafvs
    gtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekptaif
    vgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigavamrl
    ltkymnketvdssivqlphriefrqstk