PDB entry 2hs0

View 2hs0 on RCSB PDB site
Description: T. maritima PurL complexed with ATP
Class: ligase
Keywords: beta barrel; alpha-beta structure, ligase
Deposited on 2006-07-20, released 2007-01-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase II
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hs0a1, d2hs0a2, d2hs0a3, d2hs0a4
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hs0A (A:)
    mklrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnld
    dyysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiie
    giadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifgg
    atgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemveeglvegaqdlgag
    gvlsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrilei
    arkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeediveytpgkipefkrve
    feevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvthsradlalqdtywgtl
    iavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalknacefsgvpvasgnas
    lyntyqgkpipptlvvgmlgkvnpqkvakpkpskvfavgwndfelerekelwrairklse
    egafilsssqlltrthvetfreyglkievklpevrpahqmvlvfsertpvvdvpvkeigt
    lsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hs0A (A:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
    yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
    iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifgga
    tgrdgiiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivh
    ldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaevieepvy
    rvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydgtdtvv
    ppgfgaavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplaitnc
    vnygdpdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlgkvn
    pqkvakpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfrey
    glkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr