PDB entry 2hry

View 2hry on RCSB PDB site
Description: T. maritima PurL complexed with AMPPCP
Class: ligase
Keywords: beta barrel; alpha-beta structure, ligase
Deposited on 2006-07-20, released 2007-01-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.185
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase II
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0X3 (Start-602)
      • engineered (71)
    Domains in SCOPe 2.01: d2hrya1, d2hrya2, d2hrya3, d2hrya4
  • Heterogens: MG, PO4, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hryA (A:)
    mklrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnld
    dyysvafkiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiie
    giadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifgg
    atgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemveeglvegaqdlgag
    gvlsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrilei
    arkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeediveytpgkipefkrve
    feevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvthsradlalqdtywgtl
    iavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalknacefsgvpvasgnas
    lyntyqgkpipptlvvgmlgkvnpqkvakpkpskvfavgwndfelerekelwrairklse
    egafilsssqlltrthvetfreyglkievklpevrpahqmvlvfsertpvvdvpvkeigt
    lsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hryA (A:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgvvnlddyysvaf
    kiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiadygn
    sigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifggatgrdgi
    vgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivhldrvplre
    pdmepweilisesqermavvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndl
    vmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfg
    aavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplaitncvnygd
    pdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkva
    kpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglkie
    vklpevrpahqmvlvfsertpvvdvpvkeigtlsr