PDB entry 2hrv

View 2hrv on RCSB PDB site
Description: 2a cysteine proteinase from human rhinovirus 2
Class: hydrolase
Keywords: hydrolase (cysteine proteinase)
Deposited on 1999-04-29, released 2000-05-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2a cysteine proteinase
    Species: Human rhinovirus 2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hrva_
  • Chain 'B':
    Compound: 2a cysteine proteinase
    Species: Human rhinovirus 2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hrvb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hrvA (A:)
    gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
    ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
    taggdnhvafidlrhfhcaeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrvA (A:)
    gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
    ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
    taggdnhvafidlrhfhca
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hrvB (B:)
    gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
    ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
    taggdnhvafidlrhfhcaeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrvB (B:)
    gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
    ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
    taggdnhvafidlrhfhca