PDB entry 2hrs

View 2hrs on RCSB PDB site
Description: Crystal structure of L42H V224H design intermediate for GFP metal ion reporter
Class: luminescent protein
Keywords: metal site design, intermediate, GFP, fluorophore, reporter, LUMINESCENT PROTEIN
Deposited on 2006-07-20, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.13
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (41)
      • engineered (63)
      • chromophore (65)
      • engineered (98)
      • engineered (152)
      • engineered (162)
      • engineered (223)
    Domains in SCOPe 2.07: d2hrsa_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hrsA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkhtlkficttgklpvpwptl
    vttlgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefhtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrsA (A:)
    kgeelftgvvpilveldgdvnghkfsvsgegegdatygkhtlkficttgklpvpwptlvt
    tlgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefhtaagit