PDB entry 2hrp

View 2hrp on RCSB PDB site
Description: antigen-antibody complex
Class: complex (immunoglobulin/peptide)
Keywords: fab fragment, cross-reactivity, hiv1 protease, enzyme inhibition, complex (immunoglobulin/peptide)
Deposited on 1996-12-27, released 1997-12-31
The last revision prior to the SCOP 1.75 freeze date was dated 1997-12-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92992 (3-225)
      • conflict (4)
      • conflict (12)
      • conflict (17)
      • conflict (29-31)
      • conflict (74)
      • conflict (92)
      • insertion (98-99)
      • conflict (100-103)
      • conflict (103)
      • conflict (103)
      • conflict (103)
      • conflict (198-199)
      • conflict (202)
    Domains in SCOP 1.75: d2hrph1, d2hrph2
  • Chain 'L':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92993 (2-End)
      • conflict (3)
      • conflict (17-18)
      • conflict (26)
      • conflict (33)
      • conflict (35)
      • conflict (37)
      • conflict (39)
      • conflict (53)
      • conflict (57-58)
      • conflict (77)
      • conflict (81)
      • conflict (86)
      • conflict (88)
      • conflict (95-96)
      • conflict (99)
      • conflict (103)
    Domains in SCOP 1.75: d2hrpl1, d2hrpl2
  • Chain 'M':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92993 (2-217)
      • conflict (3)
      • conflict (17-18)
      • conflict (26)
      • conflict (33)
      • conflict (35)
      • conflict (37)
      • conflict (39)
      • conflict (53)
      • conflict (57-58)
      • conflict (77)
      • conflict (81)
      • conflict (86)
      • conflict (88)
      • conflict (95-96)
      • conflict (99)
      • conflict (103)
    Domains in SCOP 1.75: d2hrpm1, d2hrpm2
  • Chain 'N':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92992 (3-End)
      • conflict (4)
      • conflict (12)
      • conflict (17)
      • conflict (29-31)
      • conflict (74)
      • conflict (92)
      • insertion (98-99)
      • conflict (100-103)
      • conflict (103)
      • conflict (103)
      • conflict (103)
      • conflict (198-199)
      • conflict (202)
    Domains in SCOP 1.75: d2hrpn1, d2hrpn2
  • Chain 'P':
    Compound: hiv-1 protease peptide
  • Chain 'Q':
    Compound: hiv-1 protease peptide
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpH (H:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hrpL (L:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrpL (L:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpM (M:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2hrpN (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrpN (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.