PDB entry 2hrn

View 2hrn on RCSB PDB site
Description: Solution Structure of Cu(I) P174L-HSco1
Class: metal transport
Keywords: Chaperone, Mitochondrion, 3D-structure, Metal binding, Disease mutation, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL TRANSPORT
Deposited on 2006-07-20, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SCO1 protein homolog, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: SCO1, SCOD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75880 (3-172)
    • cloning artifact (0-2)
    • engineered (45)
  Domains in SCOPe 2.08: d2hrna1, d2hrna2
• Heterogens: CU1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hrnA (A:)
  sftgkpllggpfsltthtgerktdkdylgqwlliyfgfthcpdvcleelekmiqvvdeid
  sittlpdltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspg
  pkdededyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks