PDB entry 2hrl

View 2hrl on RCSB PDB site
Description: Siglec-7 in complex with GT1b
Class: cell adhesion
Keywords: Ig-like domain, Siglec, Ganglioside, Siglec-7, CELL ADHESION
Deposited on 2006-07-20, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid-binding Ig-like lectin 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hrla_
  • Heterogens: NAG, CEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hrlA (A:)
    gqksnrkdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkap
    vatnnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykyd
    qlsvnvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrlA (A:)
    dysltmqssvtvqegmcvhvrcsfsypvdsdpvhgywfragndiswkapvatnnpawavq
    eetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt