PDB entry 2hrk

View 2hrk on RCSB PDB site
Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes
Class: ligase/RNA Binding Protein
Keywords: protein complex protein interaction GST-fold, ligase/RNA Binding Protein COMPLEX
Deposited on 2006-07-20, released 2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase, cytoplasmic
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GUS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hrkb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2hrkB (B:)
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
hd

    Sequence, based on observed residues (ATOM records): (download) 
    >2hrkB (B:)
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
h