PDB entry 2hrj

View 2hrj on RCSB PDB site
Description: NMR solution structure of the F2 subdomain of talin
Class: structural protein
Keywords: ACBP-like, talin, STRUCTURAL PROTEIN
Deposited on 2006-07-20, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Talin-1
  Species: Gallus gallus [TaxId:9031]
  Gene: Tln1, Tln
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54939 (0-120)
  Domains in SCOPe 2.08: d2hrja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hrjA (A:)
  etlllrrkffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfg
  phneqkhkpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslkty
  g