PDB entry 2hrc

View 2hrc on RCSB PDB site
Description: 1.7 angstrom structure of human ferrochelatase variant R115L
Class: lyase
Keywords: Heme synthesis, Ferrochelatase, Protoporphyrin IX, LYASE
Deposited on 2006-07-20, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.221
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Homo sapiens [TaxId:9606]
    Gene: FECH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22830
      • engineered (50)
    Domains in SCOPe 2.07: d2hrca_
  • Chain 'B':
    Compound: Ferrochelatase
    Species: Homo sapiens [TaxId:9606]
    Gene: FECH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22830 (0-358)
      • engineered (50)
    Domains in SCOPe 2.07: d2hrcb_
  • Heterogens: CL, FES, IMD, CHD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrcA (A:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrcB (B:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql