PDB entry 2hrb

View 2hrb on RCSB PDB site
Description: Crystal Structure of human Carbonyl Reductase 3, complexed with NADP+
Class: Oxidoreductase
Keywords: Retinol, dehydrogenase, peroxisome, structural genomics, short-chain dehydrogenase/reductase, structural genomics consortium, SGC, Oxidoreductase
Deposited on 2006-07-20, released 2006-08-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonyl reductase [NADPH] 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75828 (2-273)
      • expression tag (1)
    Domains in SCOPe 2.03: d2hrba_
  • Heterogens: NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hrbA (A:)
    gsrvalvtganrgiglaiarelcrqfsgdvvltardvargqaavqqlqaeglsprfhqld
    iddlqsiralrdflrkeygglnvlvnnaavafksddpmpfdikaemtlktnffatrnmcn
    ellpimkphgrvvnisslqclrafencsedlqerfhsetltegdlvdlmkkfvedtknev
    heregwpnspygvsklgvtvlsrilarrldekrkadrilvnaccpgpvktdmdgkdsirt
    veegaetpvylallppdatepqgqlvhdkvvqnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrbA (A:)
    srvalvtganrgiglaiarelcrqfsgdvvltardvargqaavqqlqaeglsprfhqldi
    ddlqsiralrdflrkeygglnvlvnnaavafksddpmpfdikaemtlktnffatrnmcne
    llpimkphgrvvnisslqclrafencsedlqerfhsetltegdlvdlmkkfvedtknevh
    eregwpnspygvsklgvtvlsrilarrldekrkadrilvnaccpgpvktdmdgkdsirtv
    eegaetpvylallppdatepqgqlvhdkvvqnw