PDB entry 2hr6

View 2hr6 on RCSB PDB site
Description: Crystal structure of dUTPase in complex with substrate analogue dUDP and manganese
Class: Hydrolase
Keywords: JELLY ROLL, ENZYME-LIGAND-metal COMPLEX, Hydrolase
Deposited on 2006-07-19, released 2007-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.152
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d2hr6a2, d2hr6a3
  • Heterogens: MN, DUD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hr6A (A:)
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

    Sequence, based on observed residues (ATOM records): (download) 
    >2hr6A (A:)
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfd