PDB entry 2hr5

View 2hr5 on RCSB PDB site
Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form
Class: metal binding protein
Keywords: PF1283, PFU-1210814, Rubrerythrin, Pyrococcus furiosus, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, METAL BINDING PROTEIN
Deposited on 2006-07-19, released 2006-10-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hr5a1, d2hr5a2
  • Chain 'B':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hr5b1, d2hr5b2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hr5A (A:)
    mvvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhf
    ialgklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihael
    yrkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr5A (A:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hr5B (B:)
    mvvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhf
    ialgklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihael
    yrkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr5B (B:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe