PDB entry 2hr3

View 2hr3 on RCSB PDB site
Description: Crystal structure of putative transcriptional regulator protein from Pseudomonas aeruginosa PA01 at 2.4 A resolution
Class: transcription
Keywords: MCSG, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, TRANSCRIPTION
Deposited on 2006-07-19, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3067
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZE1
      • modified residue (61)
      • modified residue (118)
    Domains in SCOPe 2.08: d2hr3a1
  • Chain 'B':
    Compound: probable transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3067
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZE1
      • modified residue (61)
      • modified residue (118)
    Domains in SCOPe 2.08: d2hr3b_
  • Chain 'C':
    Compound: probable transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3067
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZE1
      • modified residue (61)
      • modified residue (118)
    Domains in SCOPe 2.08: d2hr3c_
  • Chain 'D':
    Compound: probable transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3067
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZE1
      • modified residue (61)
      • modified residue (118)
    Domains in SCOPe 2.08: d2hr3d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hr3A (A:)
    mptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaae
    rmrssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramh
    acldeserallaaagplltrlaqfeep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr3A (A:)
    ptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaer
    mrssnlaallrelergglivrhartrvslssegrrnlygnrakreewlvramhacldese
    rallaaagplltrlaqfee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hr3B (B:)
    mptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaae
    rmrssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramh
    acldeserallaaagplltrlaqfeep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr3B (B:)
    tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
    rssnlaallrelergglivrhtrvslssegrrnlygnrakreewlvramhacldeseral
    laaagplltrlaqfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hr3C (C:)
    mptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaae
    rmrssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramh
    acldeserallaaagplltrlaqfeep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr3C (C:)
    tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
    rssnlaallrelergglivrhadrtrvslssegrrnlygnrakreewlvramhacldese
    rallaaagplltrlaqfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hr3D (D:)
    mptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaae
    rmrssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramh
    acldeserallaaagplltrlaqfeep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr3D (D:)
    ptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaer
    mrssnlaallrelergglivrhadprtrvslssegrrnlygnrakreewlvramhaclde
    serallaaagplltrlaqfe