PDB entry 2hqx

View 2hqx on RCSB PDB site
Description: Crystal structure of human P100 tudor domain conserved region
Class: transcription
Keywords: HUMAN P100 TUDOR DOMAIN, PROTEOLYTIC FRAGMENT, PSI, STRUCTURAL GENOMICS, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, Protein Structure Initiative, SECSG
Deposited on 2006-07-19, released 2006-10-10
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.232
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p100 co-activator tudor domain
    Species: HOMO SAPIENS
    Gene: SND1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4
      • conflict (42-43)
    Domains in SCOP 1.75: d2hqxa1
  • Chain 'B':
    Compound: p100 co-activator tudor domain
    Species: HOMO SAPIENS
    Gene: SND1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4
      • conflict (42-43)
    Domains in SCOP 1.75: d2hqxb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hqxA (A:)
    pveevmpvleekersasykpvfvteitddlhfyvqdvetgtqfqklmenmrndiashppv
    egsyaprrgefciakfvdgewyrarvekvespakihvfyidygnrevlpstrlgtlspaf
    strvlpaqateyafafiqvpqdddartdavdsvvrdiqntqcllnvehlsagcphvtlqf
    adskgdvglglvkeglvmvevrkekqfqkviteylnaqesaksarlnlwrygdfraddad
    efgysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqxA (A:)
    tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
    dygnrevlpstrlgtlspafstrvlpaqat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hqxB (B:)
    pveevmpvleekersasykpvfvteitddlhfyvqdvetgtqfqklmenmrndiashppv
    egsyaprrgefciakfvdgewyrarvekvespakihvfyidygnrevlpstrlgtlspaf
    strvlpaqateyafafiqvpqdddartdavdsvvrdiqntqcllnvehlsagcphvtlqf
    adskgdvglglvkeglvmvevrkekqfqkviteylnaqesaksarlnlwrygdfraddad
    efgysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqxB (B:)
    tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
    dygnrevlpstrlgtlspafstrvlpaqat