PDB entry 2hqv

View 2hqv on RCSB PDB site
Description: X-ray Crystal Structure of Protein AGR_C_4470 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR92.
Class: structural genomics, unknown function
Keywords: NESG, AtR92, AGR_C_4470, Q7CX01_AGRT5, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-07-19, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AGR_C_4470p
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_C_4470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CX01
      • modified residue (13)
      • modified residue (78)
      • modified residue (86)
      • modified residue (149)
      • modified residue (156)
    Domains in SCOPe 2.08: d2hqva1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hqvA (A:)
    manairlppeaypmsiaaqkndddrqaralaalaekpdgiveaiaakaevapaeilailp
    qgaavsapadrfdaiwnemrgwgeilmivqtgdivlevpghlpegteshgwfnihgdspi
    gghikkdncaaitfvdrgfhgrrscsvwfmnaaggamfkifvrrdenkellagqlakfee
    lrdgfrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqvA (A:)
    aypmsiaaqkndddrqaralaalaekpeaiaakaevapaeilailpqgaavsapadrfda
    iwnemrgwgeilmivqtgdivlevpghlpegteshgwfnihgdspigghikkdncaaitf
    vdrgfhgrrscsvwfmnaaggamfkifvrrdenkellagqlakfeelrdgfr