PDB entry 2hqk

View 2hqk on RCSB PDB site
Description: Crystal structure of a monomeric cyan fluorescent protein derived from Clavularia
Class: luminescent protein
Keywords: 11-stranded beta barrel, LUMINESCENT PROTEIN
Deposited on 2006-07-18, released 2007-01-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.149
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyan fluorescent chromoprotein
    Species: Clavularia sp. [TaxId:86521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y3 (0-End)
      • engineered mutation (36)
      • engineered mutation (38)
      • engineered mutation (56-57)
      • chromophore (60)
      • engineered mutation (64)
      • engineered mutation (72-73)
      • engineered mutation (115-117)
      • engineered mutation (119)
      • engineered mutation (133-134)
      • engineered mutation (136-137)
      • engineered mutation (141)
      • engineered mutation (150)
      • engineered mutation (153-154)
      • engineered mutation (156)
      • engineered mutation (165)
      • engineered mutation (167)
      • engineered mutation (171)
      • engineered mutation (174)
      • engineered mutation (178)
      • engineered mutation (205)
      • engineered mutation (208)
      • engineered mutation (213)
    Domains in SCOPe 2.03: d2hqka_
  • Heterogens: ZN, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hqkA (A:)
    gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydilttaf
    xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
    nfppngpvmqkkttgwdastermyvrdgvlkgdvkhkllleggghhrvdfktiyrakkav
    klpdyhfvdhrieilnhdkdynkvtvyesavarnstdgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqkA (A:)
    gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydilttaf
    xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
    nfppngpvmqkkttgwdastermyvrdgvlkgdvkhkllleggghhrvdfktiyrakkav
    klpdyhfvdhrieilnhdkdynkvtvyesavarn