PDB entry 2hqh

View 2hqh on RCSB PDB site
Description: Crystal structure of p150Glued and CLIP-170
Class: structural protein, protein binding
Keywords: beta/beta structure, zinc finger motif, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2006-07-18, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hqha_
  • Chain 'B':
    Compound: Dynactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hqhb_
  • Chain 'C':
    Compound: Dynactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hqhc_
  • Chain 'D':
    Compound: Dynactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hqhd_
  • Chain 'E':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: RSN, CYLN1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: RSN, CYLN1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: RSN, CYLN1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: RSN, CYLN1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hqhA (A:)
    gsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvq
    grkyftcdeghgifvrqsqiqvfedgadttspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqhA (A:)
    plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
    gifvrqsqiqvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hqhB (B:)
    gsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvq
    grkyftcdeghgifvrqsqiqvfedgadttspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqhB (B:)
    plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
    gifvrqsqiqvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hqhC (C:)
    gsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvq
    grkyftcdeghgifvrqsqiqvfedgadttspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqhC (C:)
    lrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdeghg
    ifvrqsqiqvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hqhD (D:)
    gsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvq
    grkyftcdeghgifvrqsqiqvfedgadttspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqhD (D:)
    plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
    gifvrqsqiqvf
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.