PDB entry 2hqe

View 2hqe on RCSB PDB site
Description: Crystal structure of human P100 Tudor domain: Large fragment
Class: transcription
Keywords: P100 Tudor domain, Large fragment, Human, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, TRANSCRIPTION
Deposited on 2006-07-18, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p100 co-activator tudor domain
    Species: Homo sapiens [TaxId:9606]
    Gene: SND1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4
      • variant (42-43)
  • Chain 'B':
    Compound: p100 co-activator tudor domain
    Species: Homo sapiens [TaxId:9606]
    Gene: SND1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4
      • variant (42-43)
    Domains in SCOPe 2.08: d2hqeb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2hqeB (B:)
pveevmpvleekersasykpvfvteitddlhfyvqdvetgtqfqklmenmrndiashppv
egsyaprrgefciakfvdgewyrarvekvespakihvfyidygnrevlpstrlgtlspaf
strvlpaqateyafafiqvpqdddartdavdsvvrdiqntqcllnvehlsagcphvtlqf
adskgdvglglvkeglvmvevrkekqfqkviteylnaqesaksarlnlwrygdfraddad
efgysr

    Sequence, based on observed residues (ATOM records): (download) 
    >2hqeB (B:)
tqfqklmenmrndiashppyaprrgefciakfvdgewyrarvekvespakihvfyidygn
revlpstrlgtlspafstrvlpaqate