PDB entry 2hq9

View 2hq9 on RCSB PDB site
Description: Crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 A resolution
Class: flavoprotein
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, flavoprotein
Deposited on 2006-07-18, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mll6688 protein
    Species: Mesorhizobium loti [TaxId:381]
    Gene: NP_107146.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q988L5 (1-148)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (50)
      • modified residue (58)
      • leader sequence (0)
    Domains in SCOPe 2.08: d2hq9a1, d2hq9a2
  • Chain 'B':
    Compound: Mll6688 protein
    Species: Mesorhizobium loti [TaxId:381]
    Gene: NP_107146.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q988L5 (1-End)
      • modified residue (1)
      • modified residue (50)
      • modified residue (58)
    Domains in SCOPe 2.08: d2hq9b_
  • Heterogens: CL, FAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hq9A (A:)
    gmlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmr
    anprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalk
    pvtpptadsaphvffrilieqvsgrease
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq9A (A:)
    gmlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmr
    anprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwweaphvf
    frilieqvsgrease
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hq9B (B:)
    gmlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmr
    anprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalk
    pvtpptadsaphvffrilieqvsgrease
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq9B (B:)
    mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
    nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalsa
    phvffrilieqvsgreas